mirror of
https://github.com/NVIDIA/dgx-spark-playbooks.git
synced 2026-06-24 15:19:30 +00:00
262 lines
12 KiB
Python
262 lines
12 KiB
Python
#!/usr/bin/env python3
|
|
"""Build a self-contained 3D protein-ligand viewer with inline JS libraries.
|
|
|
|
Usage:
|
|
python build_viewer.py --drug metformin
|
|
python build_viewer.py --drug metformin --sequence CUSTOMSEQ --title "Custom Title"
|
|
|
|
When --sequence is omitted, the script looks up the protein target from a
|
|
built-in drug-target table (drug name -> target protein -> amino acid sequence).
|
|
Fetches drug SMILES from PubChem, predicts a protein-ligand complex with
|
|
OpenFold3 NIM, and generates an interactive 3D viewer saved to canvas.
|
|
"""
|
|
import argparse, subprocess, json, os, sys
|
|
|
|
CANVAS = os.path.expanduser("~/.openclaw/canvas")
|
|
OF3_HOST = os.environ.get("OPENFOLD3_HOST", "172.17.0.1")
|
|
OF3_URL = f"http://{OF3_HOST}:8000/biology/openfold/openfold3/predict"
|
|
PUBCHEM_URL = "https://pubchem.ncbi.nlm.nih.gov/rest/pug/compound/name/{}/property/IsomericSMILES/JSON"
|
|
|
|
# Drug -> (target protein name, amino acid sequence)
|
|
# Sequences are canonical fragments from UniProt, chosen to be under 300 aa
|
|
# for fast OpenFold3 prediction while covering the drug binding domain.
|
|
DRUG_TARGETS = {
|
|
"metformin": (
|
|
"Insulin B-chain",
|
|
"FVNQHLCGSHLVEALYLVCGERGFFYTPKT",
|
|
),
|
|
"atorvastatin": (
|
|
"HMG-CoA reductase (catalytic domain)",
|
|
"EIGTVGGGTQLFNQLESRIRAVLKDAGFLEEARAVIDRPGPYLEDVVTASNLKEGATLITSPAKLLREVGLTPETISKALKESGVRFIRIATTAPYAMNPVSAVEIAGATLYPVSALTEIARGMFVFQSGKYSMSSSGIVLPVVFATLME",
|
|
),
|
|
"rosuvastatin": (
|
|
"HMG-CoA reductase (catalytic domain)",
|
|
"EIGTVGGGTQLFNQLESRIRAVLKDAGFLEEARAVIDRPGPYLEDVVTASNLKEGATLITSPAKLLREVGLTPETISKALKESGVRFIRIATTAPYAMNPVSAVEIAGATLYPVSALTEIARGMFVFQSGKYSMSSSGIVLPVVFATLME",
|
|
),
|
|
"lisinopril": (
|
|
"ACE (binding domain)",
|
|
"QGSERRGPFKSWYGSSPDIIRDQIRKQLQELLQELNEERDCTSIHPFHNIFSEDDASFEERKVLKNMMDTLKRNVQEAVDTYGFK",
|
|
),
|
|
"enalapril": (
|
|
"ACE (binding domain)",
|
|
"QGSERRGPFKSWYGSSPDIIRDQIRKQLQELLQELNEERDCTSIHPFHNIFSEDDASFEERKVLKNMMDTLKRNVQEAVDTYGFK",
|
|
),
|
|
"losartan": (
|
|
"Angiotensin II receptor type 1 (transmembrane domain)",
|
|
"MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTRMSTLSYRPSDNVSSSTKKPAPCFEVE",
|
|
),
|
|
"amlodipine": (
|
|
"L-type calcium channel Cav1.2 (domain III)",
|
|
"QCIDDYDTQFFLQDNAKFEGMCLRDIPDDRDNFDLFLKRVDIGPEDYYLNQHFLDAAENPDPEISFQFEGRILRGFIDIIYDLSDWFDPNEDY",
|
|
),
|
|
"empagliflozin": (
|
|
"SGLT2 (sodium-glucose cotransporter 2)",
|
|
"MDSSRQSGAHQHPPAQRVELQGLADEADARALRGEFSLHPELAARAATPEQAFALGGELPMERDSQLCMGFVHTYFNMTGYSEAETLTGAGPPMAYAIPPQAKEVEEMKEFFQKFGKTYPGLKDIFPETKIDFLRNIMLQHMGIGLASATLVPMYIAAEMTAHMGCMHRFLYASYVAAEFLAIVFAVILFNLGERRKHFS",
|
|
),
|
|
"semaglutide": (
|
|
"GLP-1 receptor (extracellular domain)",
|
|
"RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERNSPEEQLLS",
|
|
),
|
|
}
|
|
|
|
|
|
def fetch_js(url):
|
|
r = subprocess.run(["curl", "-sL", url], capture_output=True, text=True, timeout=30)
|
|
if r.returncode != 0:
|
|
print(f" ERROR: curl failed for {url} (exit {r.returncode})", file=sys.stderr)
|
|
if r.stderr:
|
|
print(f" {r.stderr[:300]}", file=sys.stderr)
|
|
raise RuntimeError(f"Failed to fetch {url}")
|
|
if len(r.stdout) < 1000:
|
|
print(f" WARN: {url} returned only {len(r.stdout)} bytes", file=sys.stderr)
|
|
return r.stdout
|
|
|
|
|
|
def lookup_smiles(drug):
|
|
try:
|
|
r = subprocess.run(
|
|
["curl", "-sf", PUBCHEM_URL.format(drug)],
|
|
capture_output=True, text=True, timeout=15
|
|
)
|
|
d = json.loads(r.stdout)
|
|
props = d["PropertyTable"]["Properties"][0]
|
|
return props.get("IsomericSMILES", props.get("CanonicalSMILES", props.get("SMILES", "")))
|
|
except Exception as e:
|
|
print(f" PubChem lookup failed: {e}", file=sys.stderr)
|
|
return ""
|
|
|
|
|
|
def resolve_target(drug):
|
|
"""Look up drug in built-in table. Returns (target_name, sequence) or None."""
|
|
key = drug.strip().lower()
|
|
if key in DRUG_TARGETS:
|
|
return DRUG_TARGETS[key]
|
|
for k, v in DRUG_TARGETS.items():
|
|
if k in key or key in k:
|
|
return v
|
|
return None
|
|
|
|
|
|
def predict_structure(sequence, smiles=""):
|
|
molecules = [{
|
|
"type": "protein", "id": "A", "sequence": sequence,
|
|
"msa": {"main": {"a3m": {
|
|
"alignment": f">query\n{sequence}", "format": "a3m"
|
|
}}}
|
|
}]
|
|
if smiles:
|
|
molecules.append({"type": "ligand", "smiles": smiles})
|
|
|
|
body = json.dumps({"inputs": [{
|
|
"input_id": "viewer", "molecules": molecules, "output_format": "pdb"
|
|
}]})
|
|
r = subprocess.run(
|
|
["curl", "-sf", "--max-time", "300", "-X", "POST",
|
|
"-H", "Content-Type: application/json", "-d", body, OF3_URL],
|
|
capture_output=True, text=True, timeout=305
|
|
)
|
|
if r.returncode != 0 or not r.stdout.strip():
|
|
print(f" OpenFold3 prediction failed (exit {r.returncode})", file=sys.stderr)
|
|
if r.stderr:
|
|
print(f" {r.stderr[:300]}", file=sys.stderr)
|
|
sys.exit(1)
|
|
result = json.loads(r.stdout)
|
|
out = result["outputs"][0]["structures_with_scores"][0]
|
|
return out["structure"], out
|
|
|
|
|
|
def build_html(title, drug, smiles, sequence, pdb, scores, jquery_js, mol3d_js):
|
|
pdb_escaped = pdb.replace("\\", "\\\\").replace("`", "\\`").replace("${", "\\${")
|
|
has_ligand = bool(smiles)
|
|
conf = scores.get('confidence_score', 0)
|
|
plddt = scores.get('complex_plddt_score', 0)
|
|
ptm = scores.get('ptm_score', 0)
|
|
iptm = scores.get('iptm_score', 0)
|
|
|
|
ligand_legend = f'<div class="leg-item"><div class="leg-dot" style="background:#ff4444"></div>{drug.capitalize()} (ligand)</div>' if has_ligand else ""
|
|
ligand_style = """
|
|
viewer.setStyle({chain:"B"}, {stick:{radius:0.2,colorscheme:{prop:"elem",map:{C:"#ff4444",N:"#4444ff",O:"#ff6666",S:"#ffcc00"}}}, sphere:{radius:0.4,color:"#ff4444",opacity:0.5}});""" if has_ligand else ""
|
|
|
|
return f"""<!DOCTYPE html>
|
|
<html><head><meta charset="UTF-8">
|
|
<title>{title}</title>
|
|
<script>{jquery_js}</script>
|
|
<script>{mol3d_js}</script>
|
|
<style>
|
|
body {{ margin:0; background:#0d0d0d; color:#fff; font-family:Inter,'Segoe UI',system-ui,sans-serif; overflow:hidden; }}
|
|
#header {{ position:fixed; top:0; left:0; right:0; z-index:100; background:rgba(13,13,13,0.95); padding:14px 24px; border-bottom:2px solid #76B900; display:flex; justify-content:space-between; align-items:center; backdrop-filter:blur(10px); }}
|
|
#header h1 {{ margin:0; color:#76B900; font-size:18px; font-weight:700; letter-spacing:-0.3px; }}
|
|
#header .scores {{ color:#777; font-size:11px; text-align:right; line-height:1.5; }}
|
|
#header .scores span {{ color:#76B900; font-weight:600; }}
|
|
#viewer {{ width:100vw; height:calc(100vh - 60px); margin-top:60px; }}
|
|
#legend {{ position:fixed; bottom:20px; left:20px; background:rgba(17,17,17,0.92); border:1px solid #282828; border-radius:10px; padding:14px 18px; font-size:11px; backdrop-filter:blur(12px); }}
|
|
.leg-item {{ display:flex; align-items:center; gap:8px; margin:5px 0; color:#aaa; }}
|
|
.leg-dot {{ width:12px; height:12px; border-radius:3px; flex-shrink:0; }}
|
|
#controls {{ position:fixed; bottom:20px; right:20px; background:rgba(17,17,17,0.92); border:1px solid #282828; border-radius:10px; padding:8px 14px; font-size:10px; color:#444; backdrop-filter:blur(12px); }}
|
|
</style></head><body>
|
|
<div id="header">
|
|
<h1>{title}</h1>
|
|
<div class="scores">
|
|
Predicted by <span>OpenFold3 NIM</span> · Local GPU<br>
|
|
Confidence: <span>{conf:.1%}</span> · pLDDT: <span>{plddt:.1f}</span> · pTM: <span>{ptm:.2f}</span>{f' · ipTM: <span>{iptm:.2f}</span>' if has_ligand else ''}
|
|
</div>
|
|
</div>
|
|
<div id="viewer"></div>
|
|
<div id="legend">
|
|
<div class="leg-item"><div class="leg-dot" style="background:#4a90d9"></div>Protein ({len(sequence)} aa)</div>
|
|
{ligand_legend}
|
|
</div>
|
|
<div id="controls">Drag to rotate · Scroll to zoom · Double-click toggle spin</div>
|
|
<script>
|
|
var pdb = `{pdb_escaped}`;
|
|
var viewer = $3Dmol.createViewer("viewer", {{backgroundColor:"#0d0d0d"}});
|
|
viewer.addModel(pdb, "pdb");
|
|
viewer.setStyle({{chain:"A"}}, {{cartoon:{{color:"spectrum",opacity:0.92}}}});
|
|
{ligand_style}
|
|
viewer.zoomTo();
|
|
viewer.render();
|
|
viewer.zoom(1.15, 600);
|
|
var spinning = true;
|
|
viewer.spin("y", 0.4);
|
|
document.addEventListener("dblclick", function(){{ if(spinning){{viewer.spin(false);spinning=false;}}else{{viewer.spin("y",0.4);spinning=true;}} }});
|
|
document.addEventListener("mousedown", function(e){{ if(e.button===0){{viewer.spin(false);spinning=false;}} }});
|
|
</script></body></html>"""
|
|
|
|
|
|
def main():
|
|
parser = argparse.ArgumentParser(description="Build 3D protein-ligand viewer")
|
|
parser.add_argument("--drug", required=True, help="Drug name (e.g. metformin)")
|
|
parser.add_argument("--sequence", default=None, help="Protein target sequence (auto-resolved if omitted)")
|
|
parser.add_argument("--title", default=None, help="Viewer title")
|
|
parser.add_argument("--output", default=None, help="Output HTML path")
|
|
parser.add_argument("--openfold-host", default=None, help="OpenFold3 host IP")
|
|
args = parser.parse_args()
|
|
|
|
if args.openfold_host:
|
|
global OF3_URL
|
|
OF3_URL = f"http://{args.openfold_host}:8000/biology/openfold/openfold3/predict"
|
|
|
|
sequence = args.sequence
|
|
target_name = None
|
|
if not sequence:
|
|
target = resolve_target(args.drug)
|
|
if target:
|
|
target_name, sequence = target
|
|
print(f"Target: {target_name}")
|
|
else:
|
|
print(f"ERROR: No built-in target for '{args.drug}'. Pass --sequence explicitly.", file=sys.stderr)
|
|
print(f"Known drugs: {', '.join(sorted(DRUG_TARGETS.keys()))}", file=sys.stderr)
|
|
sys.exit(1)
|
|
|
|
title = args.title or f"{args.drug.capitalize()}: {target_name or 'Protein-Ligand Complex'}"
|
|
output = args.output or os.path.join(CANVAS, f"{args.drug}_complex.html")
|
|
os.makedirs(os.path.dirname(output), exist_ok=True)
|
|
|
|
print(f"Drug: {args.drug}")
|
|
print(f"Sequence: {sequence[:40]}{'...' if len(sequence) > 40 else ''} ({len(sequence)} aa)")
|
|
|
|
print("Fetching jQuery...")
|
|
jq = fetch_js("https://code.jquery.com/jquery-3.6.0.min.js")
|
|
print(f" {len(jq)} bytes")
|
|
|
|
print("Fetching 3Dmol...")
|
|
mol3d = fetch_js("https://3Dmol.org/build/3Dmol-min.js")
|
|
print(f" {len(mol3d)} bytes")
|
|
|
|
if len(jq) < 1000 or len(mol3d) < 1000:
|
|
print("ERROR: JS library download failed", file=sys.stderr)
|
|
sys.exit(1)
|
|
|
|
print("Looking up SMILES on PubChem...")
|
|
smiles = lookup_smiles(args.drug)
|
|
print(f" SMILES: {smiles}")
|
|
|
|
pdb_cache = os.path.join(CANVAS, f"{args.drug}_complex.pdb")
|
|
scores_cache = os.path.join(CANVAS, f"{args.drug}_complex_scores.json")
|
|
if os.path.exists(pdb_cache) and os.path.getsize(pdb_cache) > 1000:
|
|
pdb = open(pdb_cache).read()
|
|
if os.path.exists(scores_cache):
|
|
scores = json.loads(open(scores_cache).read())
|
|
else:
|
|
scores = {"confidence_score": 0, "complex_plddt_score": 0, "ptm_score": 0, "iptm_score": 0}
|
|
print(f"PDB from cache: {len(pdb)} bytes")
|
|
else:
|
|
mode = "protein-ligand complex" if smiles else "protein only"
|
|
print(f"Predicting {mode} with OpenFold3...")
|
|
pdb, scores = predict_structure(sequence, smiles)
|
|
with open(pdb_cache, "w") as f:
|
|
f.write(pdb)
|
|
with open(scores_cache, "w") as f:
|
|
json.dump(scores, f, indent=2)
|
|
print(f" {len(pdb)} bytes, confidence: {scores.get('confidence_score',0):.1%}")
|
|
|
|
html = build_html(title, args.drug, smiles, sequence, pdb, scores, jq, mol3d)
|
|
with open(output, "w") as f:
|
|
f.write(html)
|
|
print(f"\nViewer saved: {output} ({len(html)} bytes)")
|
|
print(f"Open: http://localhost:18789/__openclaw__/canvas/{os.path.basename(output)}")
|
|
|
|
|
|
if __name__ == "__main__":
|
|
main()
|